close
Idi na sadržaj

FMO3

S Wikipedije, slobodne enciklopedije
FMO3
Identifikatori
AliasiFMO3
Vanjski ID-jeviOMIM: 136132 MGI: 1100496 HomoloGene: 128199 GeneCards: FMO3
EC broj1.14.13.32+ 1.14.13.8 1.14.13.148, 1.14.13.32, 1.14.13.8
Lokacija gena (čovjek)
Hromosom 1 (čovjek)
Hrom.Hromosom 1 (čovjek)[1]
Hromosom 1 (čovjek)
Genomska lokacija za FMO3
Genomska lokacija za FMO3
Bend1q24.3Početak171,090,901 bp[1]
Kraj171,117,819 bp[1]
Lokacija gena (miš)
Hromosom 1 (miš)
Hrom.Hromosom 1 (miš)[2]
Hromosom 1 (miš)
Genomska lokacija za FMO3
Genomska lokacija za FMO3
Bend1 H2.1|1 70.34 cMPočetak162,781,369 bp[2]
Kraj162,812,097 bp[2]
Obrazac RNK ekspresije


Više referentnih podataka o ekspresiji
Ontologija gena
Molekularna funkcija trimethylamine monooxygenase activity
oxidoreductase activity
N,N-dimethylaniline monooxygenase activity
NADP binding
flavin adenine dinucleotide binding
monooxygenase activity
GO:0001948, GO:0016582 vezivanje za proteine
Ćelijska komponenta integral component of membrane
organelle membrane
endoplasmic reticulum membrane
intracellular membrane-bounded organelle
Endoplazmatski retikulum
membrana
Biološki proces xenobiotic metabolic process
Izvori:Amigo / QuickGO
Ortolozi
VrsteČovjekMiš
Entrez
Ensembl
UniProt
RefSeq (mRNK)

NM_001002294
NM_006894
NM_001319173
NM_001319174

NM_008030

RefSeq (bjelančevina)

NP_001002294
NP_001306102
NP_001306103
NP_008825

NP_032056

Lokacija (UCSC)Chr 1: 171.09 – 171.12 MbChr 1: 162.78 – 162.81 Mb
PubMed pretraga[3][4]
Wikipodaci
Pogledaj/uredi – čovjekPogledaj/uredi – miš

Flavin-sadržavajuća monooksigenaza 3 (FMO3), poznata i kao dimetilanilin- monooksigenaza (formiranje N-oksida) 3 i trimetilamin-monooksigenaza, jest flavonoproteinski enzim (EC:1.14.13.148) koji je kod ljudi kodiran genom FMO3 sa hromosoma 1.[5][6][7][8]

Aminokiselinska sekvenca

[uredi | uredi izvor]

Dužina polipeptidnog lanca je 532 aminokiseline, a molekulska težina 60.033 Da.[9]

1020304050
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEG
RASIYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNL
LKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHH
VYPNLPKESFPGLNHFKGKCFHSRDYKEPGVFNGKRVLVVGLGNSGCDIA
TELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFGTFLKNNLPTA
ISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEI
ILFKGVFPPLLEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLP
SMEDMMNDINEKMEKKRKWFGKSETIQTDYIVYMDELSSFIGAKPNIPWL
FLTDPKLAMEVYFGPCSPYQFRLVGPGQWPGARNAILTQWDRSLKPMQTR
VVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT

Funkcija

[uredi | uredi izvor]

Ovaj enzim, između ostalog, katalizira sljedeće hemijske reakcije,:[8]

trimetilamin + NADPH + H+ + O2 trimetilamin N-oksid + NADP+ + H2O

FMO3 je glavna monooksigenaza koja sadrži flavinski izoenzim, a eksprimira se u jetri odraslih ljudi.[8][10] Ljudski enzim FMO3 katalizuje nekoliko tipova reakcija, uključujući: N-oksigenaciju primarnih, sekundarnih i tercijalnih amina;S-oksigenacija nukleofilnih sumpornih spojeva koji sadrže;[10] i 6-metilhidroksilacija agensa protiv raka dimetilksantenonske acetatne kiseline (DMXAA).[10][11]

FMO3 je primarni enzim kod ljudi koji katalizira N-oksidaciju trimetilamina u trimetilamin N-oksid;[8][12] FMO1 također to radi, ali u mnogo manjoj mjeri od FMO3.[13][14] Genetički nedostaci enzima FMO3 uzrokuju primarnu trimetilaminuriji, također poznatu kao "sindrom mirisa na ribu".[8][15] FMO3 također je uključena u metabolizam mnogih ksenobiotika (egzogenih spojeva kojih normalno nema u tijjelu),[10][12] kao što su proizvodi oksidativna deaminacijaoksidativne deaminacije amfetamina.[10][16][17]

Ligandi

[uredi | uredi izvor]
Lista ljudskih FMO3 supstrata, inhibitora, induktora i aktivatora
FMO3 supstrati FMO3 inhibitori FMO3 induktori FMO3 aktivatori
Endogene biomolekule
Najpoznatiji egzogeni ksenobiotici
ukazuje na umjerenu do potpunu selektivnost za FMO3 u odnosu na druge FMO izoenzime.

Uočeno je da je gen FMO3 progresivno smanjen u HPV-pozitivnim neoplazijskim keratinocitima koji potiču iz vratnee preneoplzijske lezije na različitim nivoima malignosti.[20] Iz tog razloga, FMO3 je vjerovatno povezan s tumorigenezom i može biti potencijalni prognostički marker za progresiju preneoplazijske lezije grlića maternice.[20]

Također pogledajte

[uredi | uredi izvor]

Reference

[uredi | uredi izvor]
  1. 1 2 3 GRCh38: Ensembl release 89: ENSG00000007933 - Ensembl, maj 2017
  2. 1 2 3 GRCm38: Ensembl release 89: ENSMUSG00000026691 - Ensembl, maj 2017
  3. "Human PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  4. "Mouse PubMed Reference:". National Center for Biotechnology Information, U.S. National Library of Medicine.
  5. Shephard EA, Dolphin CT, Fox MF, Povey S, Smith R, Phillips IR (juni 1993). "Localization of genes encoding three distinct flavin-containing monooxygenases to human chromosome 1q". Genomics. 16 (1): 85–9. doi:10.1006/geno.1993.1144. PMID 8486388.
  6. Dolphin CT, Riley JH, Smith RL, Shephard EA, Phillips IR (februar 1998). "Structural organization of the human flavin-containing monooxygenase 3 gene (FMO3), the favored candidate for fish-odor syndrome, determined directly from genomic DNA". Genomics. 46 (2): 260–7. doi:10.1006/geno.1997.5031. PMID 9417913.
  7. "Entrez Gene: FMO3 flavin containing monooxygenase 3".
  8. 1 2 3 4 5 6 7 8 9 10 11 12 13 "Trimethylamine monooxygenase (Homo sapiens)". BRENDA. Technische Universität Braunschweig. juli 2016. Pristupljeno 18. 9. 2016. trimethylaminuria (fish-odor syndrome) is associated with defective hepatic N-oxidation of dietary-derived trimethylamine catalyzed by flavin-containing monooxygenase ... FMO3 deficiency results in trimethylaminuria or the fish-like odour syndrome ... isozyme FMO3 regulates the conversion of N,N,N-trimethylamine into its N-oxide and hence controls the release of volatile N,N,N-trimethylamine from the individual
  9. "UniProt, P31513" (jezik: en.). Pristupljeno 11. 12. 2021.CS1 održavanje: nepoznati jezik (link)
  10. 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 Krueger SK, Williams DE (juni 2005). "Mammalian flavin-containing monooxygenases: structure/function, genetic polymorphisms and role in drug metabolism". Pharmacol. Ther. 106 (3): 357–387. doi:10.1016/j.pharmthera.2005.01.001. PMC 1828602. PMID 15922018. A second precaution with respect to predicting FMO enzyme substrate specificity is that factors other than size and charge must play a role, but these parameters are not well understood. An example is the high selectivity observed with human FMO3, compared to the other FMO enzymes, in the N-oxygenation of the important constitutive substrate trimethylamine (Lang et al., 1998). ... The most efficient human FMO in phenethylamine N-oxygenation is FMO3, the major FMO present in adult human liver; the Km is between 90 and 200 μM (Lin & Cashman, 1997b). ... Of particular significance for this review is that individuals homozygous for certain FMO3 allelic variants (e.g., null variants) also demonstrate impaired metabolism toward other FMO substrates including ranitidine, nicotine, thio-benzamide, and phenothiazine derivatives (Table 4; Cashman et al., 1995, 2000; Kang et al., 2000; Cashman, 2002; Park et al., 2002; Lattard et al., 2003a, 2003b). ... The metabolic activation of ethionamide by the bacterial FMO is the same as the mammalian FMO activation of thiobenzamide to produce hepatotoxic sulfinic and sulfinic acid metabolites. Not surprisingly, Dr. Ortiz de Montellano's laboratory and our own have found ethionamide to be a substrate for human FMO1, FMO2, and FMO3 (unpublished observations).
    Table 5: N-containing drugs and xenobiotics oxygenated by FMO
    Table 6: S-containing drugs and xenobiotics oxygenated by FMO
    Table 7: FMO activities not involving S- or N-oxygenation
  11. 1 2 Zhou S, Kestell P, Paxton JW (juli 2002). "6-methylhydroxylation of the anti-cancer agent 5,6-dimethylxanthenone-4-acetic acid (DMXAA) by flavin-containing monooxygenase 3". Eur J Drug Metab Pharmacokinet. 27 (3): 179–183. doi:10.1007/bf03190455. PMID 12365199. S2CID 21583717. Only FMO3 formed 6-OH-MXAA at a similar rate to that in cDNA-expressed cytochromes P-450 (CYP)1A2. The results of this study indicate that human FMO3 has the capacity to form 6-OH-MXAA, but plays a lesser important role for this reaction than CYP1A2 that has been demonstrated to catalyse 6-OH-MXAA formation.
  12. 1 2 3 4 5 6 7 8 Hisamuddin IM, Yang VW (juni 2007). "Genetic polymorphisms of human flavin-containing monooxygenase 3: implications for drug metabolism and clinical perspectives". Pharmacogenomics. 8 (6): 635–643. doi:10.2217/14622416.8.6.635. PMC 2213907. PMID 17559352. Other drug substrates have been used for both in vitro and in vivo analyses. ... FMO3 is the most abundantly expressed FMO in the adult human liver [12]. Its structure and function and the implications of its polymorphisms have been widely studied [8,12,13]. This enzyme has a wide substrate specificity, including the dietary-derived tertiary amines trimethylamine, tyramine and nicotine; commonly used drugs including cimetidine, ranitidine, clozapine, methimazole, itopride, ketoconazole, tamoxifen and sulindac sulfide; and agrichemicals, such as organophosphates and carbamates [14–22].
  13. Tang WH, Hazen SL (oktobar 2014). "The contributory role of gut microbiota in cardiovascular disease". J. Clin. Invest. 124 (10): 4204–4211. doi:10.1172/JCI72331. PMC 4215189. PMID 25271725. In recent studies each of the FMO family members were cloned and expressed, to determine which possessed synthetic capacity to use TMA as a substrate to generate TMAO. FMO1, FMO2, and FMO3 were all capable of forming TMAO, though the specific activity of FMO3 was at least 10-fold higher than that the other FMOs (54). Further, FMO3 overexpression in mice significantly increased plasma TMAO levels, while silencing FMO3 decreased TMAO levels (54). In both humans and mice, hepatic FMO3 expression was observed to be reduced in males compared with females (25, 54) and could be induced by dietary bile acids through a mechanism that involves FXR (54).
  14. Bennett BJ, de Aguiar Vallim TQ, Wang Z, Shih DM, Meng Y, Gregory J, Allayee H, Lee R, Graham M, Crooke R, Edwards PA, Hazen SL, Lusis AJ (2013). "Trimethylamine-N-oxide, a metabolite associated with atherosclerosis, exhibits complex genetic and dietary regulation". Cell Metab. 17 (1): 49–60. doi:10.1016/j.cmet.2012.12.011. PMC 3771112. PMID 23312283. Circulating trimethylamine-N-oxide (TMAO) levels are strongly associated with atherosclerosis. We now examine genetic, dietary, and hormonal factors regulating TMAO levels. We demonstrate that two flavin mono-oxygenase family members, FMO1 and FMO3, oxidize trimethylamine (TMA), derived from gut flora metabolism of choline, to TMAO. Further, we show that FMO3 exhibits 10-fold higher specific activity than FMO1.
  15. Dolphin CT, Janmohamed A, Smith RL, Shephard EA, Phillips IR (1997). "Missense mutation in flavin-containing mono-oxygenase 3 gene, FMO3, underlies fish-odour syndrome". Nat. Genet. 17 (4): 491–4. doi:10.1038/ng1297-491. PMID 9398858. S2CID 24732203.
  16. Glennon RA (2013). "Phenylisopropylamine stimulants: amphetamine-related agents". u Lemke TL, Williams DA, Roche VF, Zito W (ured.). Foye's principles of medicinal chemistry (7th izd.). Philadelphia, USA: Wolters Kluwer Health/Lippincott Williams & Wilkins. str. 646–648. ISBN 9781609133450. The simplest unsubstituted phenylisopropylamine, 1-phenyl-2-aminopropane, or amphetamine, serves as a common structural template for hallucinogens and psychostimulants. Amphetamine produces central stimulant, anorectic, and sympathomimetic actions, and it is the prototype member of this class (39). ... The phase 1 metabolism of amphetamine analogs is catalyzed by two systems: cytochrome P450 and flavin monooxygenase.
  17. 1 2 3 Cashman JR, Xiong YN, Xu L, Janowsky A (mart 1999). "N-oxygenation of amphetamine and methamphetamine by the human flavin-containing monooxygenase (form 3): role in bioactivation and detoxication". J. Pharmacol. Exp. Ther. 288 (3): 1251–1260. PMID 10027866.
  18. 1 2 3 4 5 Robinson-Cohen C, Newitt R, Shen DD, Rettie AE, Kestenbaum BR, Himmelfarb J, Yeung CK (august 2016). "Association of FMO3 Variants and Trimethylamine N-Oxide Concentration, Disease Progression, and Mortality in CKD Patients". PLOS ONE. 11 (8): e0161074. doi:10.1371/journal.pone.0161074. PMC 4981377. PMID 27513517. TMAO is generated from trimethylamine (TMA) via metabolism by hepatic flavin-containing monooxygenase isoform 3 (FMO3). ... FMO3 catalyzes the oxidation of catecholamine or catecholamine-releasing vasopressors, including tyramine, phenylethylamine, adrenaline, and noradrenaline [32, 33].
  19. 1 2 3 Cashman JR (septembar 2000). "Human flavin-containing monooxygenase: substrate specificity and role in drug metabolism". Curr. Drug Metab. 1 (2): 181–191. doi:10.2174/1389200003339135. PMID 11465082. Human FMO3 N-oxygenates primary, secondary and tertiary amines whereas human FMO1 is only highly efficient at N-oxygenating tertiary amines. Both human FMO1 and FMO3 S-oxygenate a number of nucleophilic sulfur-containing substrates and in some cases, does so with great stereoselectivity. ... For amines with smaller aromatic substituents such as phenethylamines, often these compounds are efficiently N-oxygenated by human FMO3. ... (S)-Nicotine N-1'-oxide formation can also be used as a highly stereoselective probe of human FMO3 function for adult humans that smoke cigarettes. Finally, cimetidine S-oxygenation or ranitidine N-oxidation can also be used as a functional probe of human FMO3. With the recent observation of human FMO3 genetic polymorphism and poor metabolism phenotype in certain human populations, variant human FMO3 may contribute to adverse drug reactions or exaggerated clinical response to certain medications.
  20. 1 2 Rotondo JC, Bosi S, Bassi C, Ferracin M, Lanza G, Gafà R, Magri E, Selvatici R, Torresani S, Marci R, Garutti P, Negrini M, Tognon M, Martini F (april 2015). "Gene expression changes in progression of cervical neoplasia revealed by microarray analysis of cervical neoplastic keratinocytes". J Cell Physiol. 230 (4): 802–812. doi:10.1002/jcp.24808. PMID 25205602. S2CID 24986454.

Dopunska literatura

[uredi | uredi izvor]

Vanjski linkovi

[uredi | uredi izvor]