MediaWiki API help
This is an auto-generated MediaWiki Action API documentation page.
informazioni generali
Stato: l'API MediaWiki è un'interfaccia matura e stabile che è attivamente supportata e migliorata. Anche se cerchiamo di evitarlo, potremmo dover fare delle modifiche che causano malfunzionamenti; iscriviti alla mailing list sugli annunci delle API MediaWiki per essere informato sugli aggiornamenti.
Istruzioni sbagliate: quando vengono impartite alle API delle istruzioni sbagliate, un'intestazione HTTP verrà inviata col messaggio "MediaWiki-API-Error" e, sia il valore dell'intestazione, sia il codice d'errore, verranno impostati con lo stesso valore. Per maggiori informazioni leggi API:Errori ed avvertimenti (in inglese).
Test: per testare facilmente le richieste API, vedi Special:ApiSandbox.
Request methods
Action API requests may use GET and POST methods. Prefer using the GET method, which allows requests to be routed to faster replica servers and responses to be cached, unless the length of the URL with parameters would exceed its length limit (commonly 8000 bytes), or a module only accepts POST requests.
Parameters for POST requests may be sent in the query part of the request URL (like in GET requests) and in the POST request body, and mixing both ways in one request is allowed. Certain parameters such as passwords must be sent in the request body. If the same parameter is sent as part of the URL and also in the request body, it must have the same value in both places.
Tipi di dato
Input to MediaWiki should be NFC-normalized UTF-8. MediaWiki may attempt to convert other input, but this may cause some operations (such as edits with MD5 checks) to fail.
Parameters that take multiple values are normally submitted with the values separated using the pipe character, e.g. param=value1|value2 or param=value1%7Cvalue2. If a value must contain the pipe character, use U+001F (Unit Separator) as the separator and prefix the value with U+001F, e.g. param=%1Fvalue1%1Fvalue2.
Some parameter types in API requests need further explanation:
- boolean
Boolean parameters work like HTML checkboxes: if the parameter is specified, regardless of value, it is considered true. For a false value, omit the parameter entirely.
- expiry
Expiry values may be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). For no expiry, use infinite, indefinite, infinity or never.
- timestamp
Timestamps may be specified in several formats, see the Timestamp library input formats documented on mediawiki.org for details. ISO 8601 date and time is recommended: 2001-01-15T14:56:00Z. The string now may be used to specify the current time.
Limiti
Most API modules can accept up to 50 inputs in multivalue parameters, and can return up to 500 results per query (50 results for slow queries).
For users with the apihighlimits right (Bot e Amministratori), the limits are increased to 500 inputs and 5 000 results (500 results for slow queries).
Parametri template
Templated parameters support cases where an API module needs a value for each value of some other parameter. For example, if there were an API module to request fruit, it might have a parameter fruits to specify which fruits are being requested and a templated parameter {fruit}-quantity to specify how many of each fruit to request. An API client that wants 1 apple, 5 bananas, and 20 strawberries could then make a request like fruits=apples|bananas|strawberries&apples-quantity=1&bananas-quantity=5&strawberries-quantity=20.
Modulo principale
- Fonte: MediaWiki
- Licenza: GPL-2.0-or-later
Specify the action to perform, the format of the response, and options that apply to all API modules.
- action
Quale azione eseguire. Questo parametro deve essere inviato come parte dell'URL della richiesta (non nel corpo della richiesta POST) per facilitare il debug, l'analisi e l'instradamento o il filtraggio delle richieste.
- abusefiltercheckmatch
- Controlla se un filtro anti abusi viene attivato da un insieme di variabili, una modifica o un evento nel registro abusi.
- abusefilterchecksyntax
- Verifica la sintassi di un filtro anti abusi.
- abusefilterevalexpression
- Valuta un'espressione del filtro anti abusi.
- abusefilterunblockautopromote
- Sblocca la possibilità di autopromozione a seguito di un blocco imposto dal filtro anti abusi.
- abuselogprivatedetails
- Visualizza i dettagli privati di una voce del registro anti abusi.
- acquiretempusername
- Acquisisce un nome utente temporaneo e lo memorizza nella sessione corrente, se la creazione di un'utenza temporanea è abilitata e l'utente attuale è disconnesso. Se un nome è già stato memorizzato, restituisce lo stesso nome.
- antispoof
- Controlla un nome utente con le verifiche di normalizzazione AntiSpoof.
- block
- Blocca un utente.
- centralauthtoken
- Recupera un centralauthtoken per l'esecuzione di una richiesta autenticata a un wiki collegato.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Modificare i dati di autenticazione per l'utente corrente.
- changecontentmodel
- Modifica il modello di contenuto di una pagina
- checktoken
- Verifica la validità di un token da action=query&meta=tokens.
- clearhasmsg
- Cancella il flag
hasmsgper l'utente corrente. - clientlogin
- Accedi al wiki utilizzando il flusso interattivo.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Ottieni le differenze tra 2 pagine.
- createaccount
- Crea un nuovo account utente.
- createlocalaccount
- Forza la creazione di un'utenza locale. L'utenza centrale deve esistere.
- delete
- Cancella una pagina.
- deleteglobalaccount
- Delete a global user.
- discussiontoolsedit
- Pubblica un messaggio su una pagina di discussione.
- discussiontoolsfindcomment
- Trova un commento tramite il suo ID o nome.
- discussiontoolsgetsubscriptions
- Get the subscription statuses of given topics.
- discussiontoolssubscribe
- Subscribe (or unsubscribe) to receive notifications about a topic.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Contrassegna tutte le notifiche come lette per l'utente attuale.
- echomarkseen
- Contrassegna le notifiche come viste per l'utente attuale.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Crea e modifica pagine.
- editmassmessagelist
- Modifica elenco di consegna per messaggi massivi.
- emailuser
- Manda un'e-mail ad un utente.
- expandtemplates
- Espande tutti i template all'interno del wikitesto.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Returns a user's contributions feed.
- feedrecentchanges
- Returns a recent changes feed.
- feedwatchlist
- Returns a watchlist feed.
- filerevert
- Ripristina un file ad una versione precedente.
- globalblock
- Blocca o sblocca globalmente un utente.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- help
- Mostra la guida per i moduli specificati.
- imagerotate
- Questo modulo è stato disabilitato.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Search for language names in any script.
- linkaccount
- Collegamento di un'utenza di un provider di terze parti all'utente corrente.
- login
- Accedi e ottieni i cookie di autenticazione.
- logout
- Esci e cancella i dati della sessione.
- managetags
- Perform management tasks relating to change tags.
- massmessage
- Send a message to a list of pages.
- mergehistory
- Unisce cronologie pagine.
- move
- Sposta una pagina.
- opensearch
- Search the wiki using the OpenSearch protocol.
- options
- Change preferences of the current user.
- paraminfo
- Ottieni informazioni sui moduli API.
- parse
- Parses content and returns parser output.
- patrol
- Verifica una pagina o versione.
- protect
- Modifica il livello di protezione di una pagina.
- purge
- Pulisce la cache per i titoli indicati.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Rimuove i dati di autenticazione per l'utente corrente.
- resetpassword
- Invia una mail per reimpostare la password di un utente.
- revisiondelete
- Cancella e ripristina le versioni.
- rollback
- Undo the last edit to the page.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- setglobalaccountstatus
- Hide or lock (or unhide or unlock) a global user account.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Cambia la lingua di una pagina.
- shortenurl
- Abbrevia un URL lungo in uno più corto.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Recupera i dati memorizzati dall'estensione TemplateData.
- thank
- Send a thank-you notification to an editor.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- unblock
- Sblocca un utente
- undelete
- Ripristina versioni di una pagina cancellata.
- unlinkaccount
- Rimuove un'utenza di terze parti collegata all'utente corrente.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Convalida una password seguendo le politiche del wiki sulle password.
- watch
- Aggiunge o rimuove pagine dagli osservati speciali dell'utente attuale.
- webapp-manifest
- Returns a webapp manifest.
- webauthn
- API Module to communicate between server and client during registration/authentication process.
- bouncehandler
- Internal. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Internal. Modulo interno per l'estensione CategoryTree.
- chartinfo
- Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Internal. Copia dei profili di CirrusSearch per questo wiki.
- cirrus-schema-dump
- Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- Internal. Check for validation errors in the given content
- collection
- Internal. API module for performing various operations on a wiki user's collection.
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- discussiontoolscompare
- Internal. Get information about comment changes between two page revisions.
- discussiontoolspageinfo
- Internal. Returns metadata required to initialize the discussion tools.
- discussiontoolspreview
- Internal. Preview a message on a discussion page.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- fancycaptchareload
- Internal. Ottieni un nuovo FancyCaptcha.
- jsondata
- Internal. Retrieve localized JSON data.
- jsontransform
- Internal. Retrieve JSON data transformed by a Lua function.
- parser-migration
- Internal. Analizza una pagina con due diverse configurazioni di parser.
- readinglists
- Internal. Reading list write operations.
- sanitize-mapdata
- Internal. Performs data validation for Kartographer extension
- scribunto-console
- Internal. Internal module for servicing XHR requests from the Scribunto console.
- securepollauth
- Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Internal. Prepare an edit in shared cache.
- timedtext
- Internal. Provides timed text content for usage by <track> elements
- ulslocalization
- Internal. Get the localization of ULS in the given language.
- ulssetlang
- Internal. Update user's preferred interface language.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- Uno dei seguenti valori: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, help, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, massmessage, mergehistory, move, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, streamconfigs, strikevote, tag, templatedata, thank, titleblacklist, torblock, transcodereset, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, collection, cspreport, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, editcheckreferenceurl, fancycaptchareload, jsondata, jsontransform, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, timedtext, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
- Predefinito: help
- format
Formato dell'output.
- Uno dei seguenti valori: json, jsonfm, none, rawfm, xml, xmlfm
- Predefinito: jsonfm
- maxlag
Il massimo ritardo può essere utilizzato quando MediaWiki è installato su un cluster replicato da un database. Per evitare che le azioni causino un ulteriore ritardo di replica del sito, questo parametro può far attendere il client finché il ritardo di replica non è inferiore al valore specificato. In caso di ritardo eccessivo, viene restituito un codice di errore maxlag con un messaggio tipo Attendi $host: $lag seconds lagged.
Vedere Manual: Maxlag parameter per ulteriori informazioni.- Type: integer
- smaxage
Imposta l'intestazione di controllo della cache HTTP
s-maxagea questo numero di secondi. Gli errori non vengono mai memorizzati nella cache.- Type: integer
- The value must be no less than 0.
- Predefinito: 0
- maxage
Imposta l'intestazione di controllo della cache HTTP
max-agea questo numero di secondi. Gli errori non vengono mai memorizzati nella cache.- Type: integer
- The value must be no less than 0.
- Predefinito: 0
- assert
Verifica che l'utente abbia effettuato l'accesso (anche come utente temporaneo) se si è impostato user, non abbia effettuato l'accesso se si è impostato anon o che abbia i permessi di bot se si è impostato bot.
- Uno dei seguenti valori: anon, bot, user
- assertuser
Verifica che l'utente corrente è l'utente nominato.
- Tipo: utente, da uno qualsiasi nome utente e Utente temporaneo
- requestid
Tutti i valori forniti saranno implementati nella risposta. Potrebbero venir utilizzati per distinguere le richieste.
- servedby
Includi nel risultato il nome dell'host che ha servito la richiesta.
- Tipo: booleano (dettagli)
- curtimestamp
Includi nel risultato il timestamp attuale.
- Tipo: booleano (dettagli)
- responselanginfo
Includi la lingua utilizzata per uselang e errorlang nel risultato.
- Tipo: booleano (dettagli)
- origin
When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).
For authenticated requests, this must match one of the origins in the
Originheader exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match theOriginheader, a 403 response will be returned. If this parameter matches theOriginheader and the origin is allowed, theAccess-Control-Allow-OriginandAccess-Control-Allow-Credentialsheaders will be set.For non-authenticated requests, specify the value *. This will cause the
Access-Control-Allow-Originheader to be set, butAccess-Control-Allow-Credentialswill befalseand all user-specific data will be restricted.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- Tipo: booleano (dettagli)
- uselang
Lingua da utilizzare per la traduzione dei messaggi. action=query&meta=siteinfo&siprop=languages restituisce un elenco di codici lingua. Puoi specificare user per utilizzare la lingua preferita dell'utente corrente, oppure content per utilizzare la lingua dei contenuti di questo wiki.
- Predefinito: user
- variant
Variante della lingua. Funziona solo se la lingua originale supporta la variante di conversione.
- errorformat
Formato da utilizzare per generare un testo di avvertenza e errore
- plaintext
- Wikitesto con etichette HTML rimosse ed entità sostituite.
- wikitext
- Unparsed wikitext.
- html
- HTML
- raw
- Chiave del messaggio e parametri.
- none
- Nessun output di testo, solo i codici di errore.
- bc
- Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
- Uno dei seguenti valori: bc, html, none, plaintext, raw, wikitext
- Predefinito: bc
- errorlang
Lingua da utilizzare per avvisi ed errori. action=query&meta=siteinfo&siprop=languages restituisce un elenco di codici lingua. Specificare content per utilizzare la lingua del contenuto di questa wiki o uselang per utilizzare lo stesso valore del parametro uselang.
- Predefinito: uselang
- errorsuselocal
Se indicato, i testi di errore impiegheranno messaggi personalizzati localmente dal namespace MediaWiki.
- Tipo: booleano (dettagli)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 60 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- Aiuto per il modulo principale.
- api.php?action=help [apri in una sandbox]
- Tutti gli aiuti in una pagina.
- api.php?action=help&recursivesubmodules=1&toc [apri in una sandbox]
Crediti
API developers:
- Yuri Astrakhan (creator, lead developer Sep 2006–Sep 2007)
- Roan Kattouw (lead developer Sep 2007–2009)
- Victor Vasiliev
- Bryan Tong Minh
- Sam Reed
- Brad Jorsch (lead developer 2013–2020)
Please send your comments, suggestions and questions to mediawiki-api@lists.wikimedia.org or file a bug report at https://phabricator.wikimedia.org/.