Trợ giúp về API MediaWiki
This is an auto-generated MediaWiki Action API documentation page.
General information
Status: The MediaWiki API is a mature and stable interface that is actively supported and improved. While we try to avoid it, we may occasionally need to make breaking changes; subscribe to the mediawiki-api-announce mailing list for notice of updates.
Erroneous requests: When erroneous requests are sent to the API, an HTTP header will be sent with the key "MediaWiki-API-Error" and then both the value of the header and the error code sent back will be set to the same value. For more information see API: Errors and warnings.
Testing: For ease of testing API requests, see Special:ApiSandbox.
Request methods
Action API requests may use GET and POST methods. Prefer using the GET method, which allows requests to be routed to faster replica servers and responses to be cached, unless the length of the URL with parameters would exceed its length limit (commonly 8000 bytes), or a module only accepts POST requests.
Parameters for POST requests may be sent in the query part of the request URL (like in GET requests) and in the POST request body, and mixing both ways in one request is allowed. Certain parameters such as passwords must be sent in the request body. If the same parameter is sent as part of the URL and also in the request body, it must have the same value in both places.
Data types
Input to MediaWiki should be NFC-normalized UTF-8. MediaWiki may attempt to convert other input, but this may cause some operations (such as edits with MD5 checks) to fail.
Parameters that take multiple values are normally submitted with the values separated using the pipe character, e.g. param=value1|value2 or param=value1%7Cvalue2. If a value must contain the pipe character, use U+001F (Unit Separator) as the separator and prefix the value with U+001F, e.g. param=%1Fvalue1%1Fvalue2.
Some parameter types in API requests need further explanation:
- boolean
Boolean parameters work like HTML checkboxes: if the parameter is specified, regardless of value, it is considered true. For a false value, omit the parameter entirely.
- expiry
Expiry values may be relative (e.g. 5 months or 2 weeks) or absolute (e.g. 2014-09-18T12:34:56Z). For no expiry, use infinite, indefinite, infinity or never.
- timestamp
Timestamps may be specified in several formats, see the Timestamp library input formats documented on mediawiki.org for details. ISO 8601 date and time is recommended: 2001-01-15T14:56:00Z. The string now may be used to specify the current time.
Limits
Most API modules can accept up to 50 inputs in multivalue parameters, and can return up to 500 results per query (50 results for slow queries).
For users with the apihighlimits right (Bot và Bảo quản viên), the limits are increased to 500 inputs and 5.000 results (500 results for slow queries).
Templated parameters
Templated parameters support cases where an API module needs a value for each value of some other parameter. For example, if there were an API module to request fruit, it might have a parameter fruits to specify which fruits are being requested and a templated parameter {fruit}-quantity to specify how many of each fruit to request. An API client that wants 1 apple, 5 bananas, and 20 strawberries could then make a request like fruits=apples|bananas|strawberries&apples-quantity=1&bananas-quantity=5&strawberries-quantity=20.
Mô đun chính
- Source: MediaWiki
- License: GPL-2.0-or-later
Specify the action to perform, the format of the response, and options that apply to all API modules.
- action
Tác vụ để thực hiện.
- abusefiltercheckmatch
- Kiểm tra xem bộ lọc sai phạm có khớp với một tập hợp các biến, một sửa đổi hoặc một mục nhật trình sai phạm hay không.
- abusefilterchecksyntax
- Kiểm tra cú pháp của bộ lọc sai phạm.
- abusefilterevalexpression
- Đánh giá một biểu thức bộ lọc sai phạm.
- abusefilterunblockautopromote
- Bỏ cấm một người dùng khỏi việc tự động cấp quyền do kích hoạt bộ lọc.
- abuselogprivatedetails
- Xem chi tiết riêng tư của nhật trình sai phạm.
- acquiretempusername
- Acquire a temporary user username and stash it in the current session, if temp account creation is enabled and the current user is logged out. If a name has already been stashed, returns the same name.
- antispoof
- Kiểm tra xem tên người dùng qua quá trình kiểm tra tiêu chuẩn của AntiSpoof.
- block
- Cấm người dùng.
- centralauthtoken
- Fetch a centralauthtoken for making an authenticated request to an attached wiki.
- centralnoticecdncacheupdatebanner
- Request the purge of banner content stored in the CDN (front-end) cache for anonymous users, for the requested banner and language
- centralnoticechoicedata
- Get data needed to choose a banner for a given project and language
- centralnoticequerycampaign
- Get all configuration settings for a campaign.
- changeauthenticationdata
- Change authentication data for the current user.
- changecontentmodel
- Change the content model of a page
- checktoken
- Check the validity of a token from action=query&meta=tokens.
- clearhasmsg
- Xóa cờ
hasmsgcho người dùng hiện tại. - clientlogin
- Log in to the wiki using the interactive flow.
- communityconfigurationedit
- Change the content of a configuration provider in Community configuration
- compare
- Get the difference between two pages.
- createaccount
- Mở tài khoản mới.
- createlocalaccount
- Forcibly create a local account. The central account must exist.
- delete
- Xóa trang.
- deleteglobalaccount
- Delete a global user.
- discussiontoolsedit
- Đăng lời bình luận trên một trang thảo luận.
- discussiontoolsfindcomment
- Find a comment by its ID or name.
- discussiontoolsgetsubscriptions
- Nhận trạng thái theo dõi của các chủ đề nhất định.
- discussiontoolssubscribe
- Theo dõi (hoặc ngừng theo dõi) để nhận thông báo về một chủ đề.
- discussiontoolsthank
- Send a public thank-you notification for a comment.
- echocreateevent
- Manually trigger a notification to a user
- echomarkread
- Mark notifications as read for the current user.
- echomarkseen
- Mark notifications as seen for the current user.
- echomute
- Mute or unmute notifications from certain users or pages.
- edit
- Tạo và sửa trang.
- editmassmessagelist
- Sửa danh sách gửi thông báo hàng loạt.
- emailuser
- Gửi thư cho người dùng.
- expandtemplates
- Bung tất cả bản mẫu trong mã wiki.
- featuredfeed
- Returns a featured content feed.
- feedcontributions
- Trả về nguồn cấp đóng góp người dùng.
- feedrecentchanges
- Trả về nguồn cấp thay đổi gần đây.
- feedwatchlist
- Trả về nguồn cấp danh sách theo dõi.
- filerevert
- Phục hồi một tập tin sang một phiên bản cũ.
- flow
- Cho phép thực hiện các tác vụ trên các trang Thảo luận Cấu trúc.
- flow-parsoid-utils
- Chuyển đổi văn bản giữa mã wiki và HTML.
- flowthank
- Gửi lời cảm ơn công khai vì một bình luận Flow.
- globalblock
- Globally block or unblock a user.
- globalpreferenceoverrides
- Change local overrides for global preferences for the current user.
- globalpreferences
- Change global preferences of the current user.
- globaluserrights
- Add/remove a user to/from global groups.
- help
- Hiển thị trợ giúp cho các mô-đun xác định.
- imagerotate
- Mô đun này đã bị vô hiệu hóa.
- import
- Import a page from another wiki, or from an XML file.
- jsonconfig
- Allows direct access to JsonConfig subsystem.
- languagesearch
- Tìm kiếm tên ngôn ngữ trong bất kỳ tập lệnh nào.
- linkaccount
- Link an account from a third-party provider to the current user.
- login
- Log in and get authentication cookies.
- logout
- Thoát ra và xóa dữ liệu phiên làm việc.
- managetags
- Perform management tasks relating to change tags.
- massmessage
- Gửi thông báo đến một danh sách các trang.
- mergehistory
- Hợp nhất lịch sử trang.
- move
- Di chuyển trang.
- opensearch
- Tìm kiếm trong wiki qua giao thức OpenSearch.
- options
- Change preferences of the current user.
- paraminfo
- Lấy thông tin về các module API.
- parse
- Parses content and returns parser output.
- patrol
- Patrol a page or revision.
- protect
- Change the protection level of a page.
- purge
- Purge the cache for the given titles.
- query
- Fetch data from and about MediaWiki.
- removeauthenticationdata
- Remove authentication data for the current user.
- resetpassword
- Send a password reset email to a user.
- revisiondelete
- Delete and undelete revisions.
- rollback
- Lùi lại sửa đổi gần đây nhất trên trang này.
- rsd
- Export an RSD (Really Simple Discovery) schema.
- setglobalaccountstatus
- Hide or lock (or unhide or unlock) a global user account.
- setnotificationtimestamp
- Update the notification timestamp for watched pages.
- setpagelanguage
- Change the language of a page.
- shortenurl
- Shorten a long URL into a shorter one.
- sitematrix
- Get Wikimedia sites list.
- spamblacklist
- Validate one or more URLs against the spam block list.
- streamconfigs
- Exposes event stream config. Returns only format=json with formatversion=2.
- strikevote
- Allows admins to strike or unstrike a vote.
- tag
- Add or remove change tags from individual revisions or log entries.
- templatedata
- Trích xuất dữ liệu được lưu bởi phần mở rộng TemplateData.
- thank
- Gửi thông báo cảm ơn đến một biên tập viên.
- titleblacklist
- Validate a page title, filename, or username against the TitleBlacklist.
- torblock
- Check if an IP address is blocked as a Tor exit node.
- transcodereset
- Users with the 'transcode-reset' right can reset and re-run a transcode job.
- unblock
- Unblock a user.
- undelete
- Undelete revisions of a deleted page.
- unlinkaccount
- Remove a linked third-party account from the current user.
- upload
- Upload a file, or get the status of pending uploads.
- userrights
- Change a user's group membership.
- validatepassword
- Validate a password against the wiki's password policies.
- watch
- Add or remove pages from the current user's watchlist.
- webapp-manifest
- Trả về bảng kê khai ứng dụng web.
- webauthn
- Mô-đun API để giao tiếp giữa máy chủ và máy khách trong quá trình đăng ký/xác thực.
- bouncehandler
- Internal. Receive a bounce email and process it to handle the failing recipient.
- categorytree
- Internal. Internal module for the CategoryTree extension.
- chartinfo
- Internal. Retrieve current count of how many unique Chart page usages there are. Multiple uses of the same chart on the same page are considered a single use.
- cirrus-check-sanity
- Internal. Reports on the correctness of a range of page ids in the search index
- cirrus-config-dump
- Internal. Dump of CirrusSearch configuration.
- cirrus-profiles-dump
- Internal. Dump of CirrusSearch profiles for this wiki.
- cirrus-schema-dump
- Internal. Dump of CirrusSearch schema (settings and mappings) for this wiki.
- codemirror-validate
- Internal. Kiểm tra lỗi trong nội dung đã cho
- cspreport
- Internal. Used by browsers to report violations of the Content Security Policy. This module should never be used, except when used automatically by a CSP compliant web browser.
- discussiontoolscompare
- Internal. Nhận thông tin về các thay đổi bình luận giữa hai lần sửa đổi trang.
- discussiontoolspageinfo
- Internal. Trả về siêu dữ liệu cần thiết để khởi tạo công cụ thảo luận.
- discussiontoolspreview
- Internal. Preview a message on a discussion page.
- editcheckreferenceurl
- Internal. Check the status of a URL for use as a reference.
- fancycaptchareload
- Internal. Get a new FancyCaptcha.
- jsondata
- Internal. Retrieve localized JSON data.
- jsontransform
- Internal. Retrieve JSON data transformed by a Lua function.
- parser-migration
- Internal. Parse a page with two different parser configurations.
- readinglists
- Internal. Reading list write operations.
- sanitize-mapdata
- Internal. Performs data validation for Kartographer extension
- scribunto-console
- Internal. Mô đun nội bộ để phản hồi các yêu cầu XHR từ console Scribunto.
- securepollauth
- Internal. Allows a remote wiki to authenticate users before granting access to vote in the election.
- stashedit
- Internal. Prepare an edit in shared cache.
- timedtext
- Internal. Provides timed text content for usage by <track> elements
- ulslocalization
- Internal. Lấy bản dịch ULS trong ngôn ngữ được chỉ định.
- ulssetlang
- Internal. Cập nhật ngôn ngữ giao diện ưa thích của người dùng.
- visualeditor
- Internal. Returns HTML5 for a page from the Parsoid service.
- visualeditoredit
- Internal. Save an HTML5 page to MediaWiki (converted to wikitext via the Parsoid service).
- wikimediaeventsblockededit
- Internal. Log information about blocked edit attempts
- wikimediaeventshcaptchaeditattempt
- Internal. Log edit diff when hCaptcha challenge is shown but edit is incomplete
- Một trong các giá trị: abusefiltercheckmatch, abusefilterchecksyntax, abusefilterevalexpression, abusefilterunblockautopromote, abuselogprivatedetails, acquiretempusername, antispoof, block, centralauthtoken, centralnoticecdncacheupdatebanner, centralnoticechoicedata, centralnoticequerycampaign, changeauthenticationdata, changecontentmodel, checktoken, clearhasmsg, clientlogin, communityconfigurationedit, compare, createaccount, createlocalaccount, delete, deleteglobalaccount, discussiontoolsedit, discussiontoolsfindcomment, discussiontoolsgetsubscriptions, discussiontoolssubscribe, discussiontoolsthank, echocreateevent, echomarkread, echomarkseen, echomute, edit, editmassmessagelist, emailuser, expandtemplates, featuredfeed, feedcontributions, feedrecentchanges, feedwatchlist, filerevert, flow-parsoid-utils, flow, flowthank, globalblock, globalpreferenceoverrides, globalpreferences, globaluserrights, help, imagerotate, import, jsonconfig, languagesearch, linkaccount, login, logout, managetags, massmessage, mergehistory, move, opensearch, options, paraminfo, parse, patrol, protect, purge, query, removeauthenticationdata, resetpassword, revisiondelete, rollback, rsd, setglobalaccountstatus, setnotificationtimestamp, setpagelanguage, shortenurl, sitematrix, spamblacklist, streamconfigs, strikevote, tag, templatedata, thank, titleblacklist, torblock, transcodereset, unblock, undelete, unlinkaccount, upload, userrights, validatepassword, watch, webapp-manifest, webauthn, bouncehandler, categorytree, chartinfo, cirrus-check-sanity, cirrus-config-dump, cirrus-profiles-dump, cirrus-schema-dump, codemirror-validate, cspreport, discussiontoolscompare, discussiontoolspageinfo, discussiontoolspreview, editcheckreferenceurl, fancycaptchareload, jsondata, jsontransform, parser-migration, readinglists, sanitize-mapdata, scribunto-console, securepollauth, stashedit, timedtext, ulslocalization, ulssetlang, visualeditor, visualeditoredit, wikimediaeventsblockededit, wikimediaeventshcaptchaeditattempt
- Default: help
- format
Định dạng của dữ liệu được cho ra.
- Một trong các giá trị: json, jsonfm, none, rawfm, xml, xmlfm
- Default: jsonfm
- maxlag
Maximum lag can be used when MediaWiki is installed on a database replicated cluster. To save actions causing any more site replication lag, this parameter can make the client wait until the replication lag is less than the specified value. In case of excessive lag, error code maxlag is returned with a message like Waiting for $host: $lag seconds lagged.
See Manual: Maxlag parameter for more information.- Type: integer
- smaxage
Set the
s-maxageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- maxage
Set the
max-ageHTTP cache control header to this many seconds. Errors are never cached.- Type: integer
- The value must be no less than 0.
- Default: 0
- assert
Verify that the user is logged in (including possibly as a temporary user) if set to user, not logged in if set to anon, or has the bot user right if bot.
- Một trong các giá trị: anon, bot, user
- assertuser
Verify the current user is the named user.
- Kiểu: người dùng, bằng một giá trị bất kỳ trong tên người dùng và Người dùng tạm thời
- requestid
Any value given here will be included in the response. May be used to distinguish requests.
- servedby
Include the hostname that served the request in the results.
- Type: boolean (details)
- curtimestamp
Include the current timestamp in the result.
- Type: boolean (details)
- responselanginfo
Include the languages used for uselang and errorlang in the result.
- Type: boolean (details)
- origin
When accessing the API using a cross-domain AJAX request (CORS), set this to the originating domain. This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).
For authenticated requests, this must match one of the origins in the
Originheader exactly, so it has to be set to something like https://en.wikipedia.org or https://meta.wikimedia.org. If this parameter does not match theOriginheader, a 403 response will be returned. If this parameter matches theOriginheader and the origin is allowed, theAccess-Control-Allow-OriginandAccess-Control-Allow-Credentialsheaders will be set.For non-authenticated requests, specify the value *. This will cause the
Access-Control-Allow-Originheader to be set, butAccess-Control-Allow-Credentialswill befalseand all user-specific data will be restricted.- crossorigin
When accessing the API using a cross-domain AJAX request (CORS) and using a session provider that is safe against cross-site request forgery (CSRF) attacks (such as OAuth), use this instead of
origin=*to make the request authenticated (i.e., not logged out). This must be included in any pre-flight request, and therefore must be part of the request URL (not the POST body).Note that most session providers, including standard cookie-based sessions, do not support authenticated CORS and cannot be used with this parameter.
- Type: boolean (details)
- uselang
Ngôn ngữ để sử dụng cho các bản dịch thông điệp. action=query&meta=siteinfo&siprop=languages trả về một danh sách các mã ngôn ngữ. Bạn có thể định rõ user để sử dụng ngôn ngữ của người dùng hiện tại hoặc content để sử dụng ngôn ngữ nội dung của wiki này.
- Default: user
- variant
Variant of the language. Only works if the base language supports variant conversion.
- errorformat
Format to use for warning and error text output
- plaintext
- Mã Wiki có thẻ HTML đã bị xóa và các thực thể đã được thay thế.
- wikitext
- Mã wiki chưa được phân tích.
- html
- HTML
- raw
- Message key and parameters.
- none
- Không có văn bản nào được hiển thị, chỉ có mã lỗi.
- bc
- Format used prior to MediaWiki 1.29. errorlang and errorsuselocal are ignored.
- Một trong các giá trị: bc, html, none, plaintext, raw, wikitext
- Default: bc
- errorlang
Language to use for warnings and errors. action=query&meta=siteinfo&siprop=languages returns a list of language codes. Specify content to use this wiki's content language or uselang to use the same value as the uselang parameter.
- Default: uselang
- errorsuselocal
If given, error texts will use locally-customized messages from the MediaWiki namespace.
- Type: boolean (details)
- centralauthtoken
When accessing the API using a cross-domain AJAX request (CORS), use this to authenticate as the current SUL user. Use action=centralauthtoken on this wiki to retrieve the token, before making the CORS request. Each token may only be used once, and expires after 60 seconds. This should be included in any pre-flight request, and therefore should be included in the request URI (not the POST body).
On this wiki the expected value is a JSON Web Token, which may be validated by proxy servers in front of MediaWiki. If the token has expired or is otherwise invalid, you may receive a HTTP error from a proxy in a different format than a normal API error.
- Trợ giúp cho các mô-đun chính.
- api.php?action=help [open in sandbox]
- Tất cả trợ giúp trong một trang
- api.php?action=help&recursivesubmodules=1&toc [open in sandbox]
Ghi công
API developers:
- Yuri Astrakhan (creator, lead developer Sep 2006–Sep 2007)
- Roan Kattouw (lead developer Sep 2007–2009)
- Victor Vasiliev
- Bryan Tong Minh
- Sam Reed
- Brad Jorsch (lead developer 2013–2020)
Please send your comments, suggestions and questions to mediawiki-api@lists.wikimedia.org or file a bug report at https://phabricator.wikimedia.org/.